JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.
Product Usage: This PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation is allowed to use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website for educational purpose only. Bodily introduction of any kind into humans and animals is strictly forbidden by law. This product should only be handled by licenced qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused as a drug, food and cosmetic.
FREE Shipping for orders over $200
For this product you will need: BACTERIOSTATIC WATER For reconstitution.
Sermorelin is an analog of growth hormone-releasing factor (GRF) with a similar structure that stimulates the release of growth hormone from the adenohypophysis, just as GRF does. Its 29-amino acid sequence is homologous to that of native GRF and allows studies of peptide–receptor interactions, receptor pharmacodynamics, and neuroendocrine axis modulation. Experimental studies have centered on molecular mechanisms, signal transduction, and regulation of the hypothalamic–pituitary–somatotropic axis.
Sermorelin has been historically developed and characterized as a GHRH analog for mechanistic studies in endocrine research. Its molecular structure is smaller than the 191-amino acid human growth hormone, allowing for targeted studies of growth hormone regulation and secretagogue activity. Sermorelin offered for sale is intended strictly for laboratory and research purposes, and is supplied exclusively to qualified researchers.
From Pubchem
Synonym: Sermorelina, 86168-78-7, SomatoliberinMolecular Formula: C149H246N44O42SMolecular Weight: 3357.9 g/molSequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRCAS Number: 86168-78-7PubChem CID: 16132413
Sermorelin is a synthetic analog of growth hormone-releasing factor (GRF) that interacts with GHRH receptors in the adenohypophysis. Its 29-amino acid structure enables detailed examination of peptide–receptor interactions, receptor pharmacodynamics, and intracellular signaling cascades. Research has investigated Sermorelin’s modulation of the hypothalamic–pituitary–somatotropic axis, emphasizing episodic receptor activation, feedback regulation via somatostatin, and mechanistic aspects of pulsatile growth hormone release [1]. The compound’s properties facilitate laboratory-level exploration of signal fidelity, receptor desensitization, and tachyphylaxis prevention in controlled experimental systems.
The neuroendocrine axis undergoes structural and functional modifications with advancing chronological parameters. Sermorelin has been employed in experimental models to investigate the modulation of age-related peptide signaling networks. It demonstrates effects on IGF-1–linked pathways, receptor-mediated transcriptional regulation, and peptide-stabilized signal propagation in neuroendocrine circuits [1]. Mechanistic evaluations of signal amplitude, duration, and downstream second-messenger interactions provide insight into peptide-mediated maintenance of hypothalamic–pituitary communication, independent of organismal or clinical outcomes [2].
Sermorelin has been used in mechanistic investigations of cardiac peptide signaling, specifically in the context of GHRH receptor–linked intracellular pathways. Experimental analyses focus on local receptor activation, signal transduction kinetics, and modulation of molecular elements involved in myocardial structural remodeling. These studies explore cardiomyocyte peptide responsiveness, molecular strain signaling, and pathway integration without extrapolating to functional endpoints or physiological performance [3].
Research on hypothalamic control of circadian rhythms has utilized Sermorelin to examine GHRH-mediated modulation of orexinergic and related neurotransmitter networks. Experimental evaluation of peptide-induced signaling fluctuations provides mechanistic insight into neuropeptide interactions, receptor occupancy dynamics, and oscillatory regulation of hypothalamic circuits [4,5]. Laboratory investigations focus on molecular-level feedback loops, synaptic peptide responsiveness, and intracellular signaling patterns.
Sermorelin is a 29-amino acid GHRH analog used in research for elucidating molecular mechanisms of hypothalamic–pituitary–somatotropic axis regulation, intracellular signal transduction, and neuroendocrine pathway integration. Current applications are strictly limited to controlled experimental and preclinical studies. Element CRP offers Sermorelin exclusively for educational and laboratory research purposes. Researchers are advised to utilize this compound solely within approved scientific frameworks.
Sermorelin is a 29-amino-acid synthetic peptide corresponding to the biologically active N-terminal fragment of human growth hormone-releasing hormone (GHRH). Its truncated structure preserves the receptor binding determinants while improving stability characteristics for in vitro cell-based research applications.
Cell-based pharmacology research with Sermorelin focuses on agonist activity at the GHRH receptor (a class B GPCR) expressed in pituitary somatotroph cell models and heterologous expression systems. Standard functional readouts include Gas-coupled cAMP elevation, downstream PKA activation, and CREB phosphorylation in cell-based assay formats.
Element CRP supplies this product at 5mg per vial. USA-manufactured via solid-phase peptide synthesis and verified at 99%+ purity by HPLC and Mass Spectrometry. Reconstitution with bacteriostatic water required. Store lyophilised at -20°C; stable for 24 months.
WARNING: For research use only. Not for human or animal consumption. Not intended to diagnose, treat, cure, or prevent any disease. For use by qualified research professionals only.
Forgot password?
Country: United States (US-only registration)
All products on this site are for Research, Development use only. Products are Not for Human consumption of any kind. The statements made within this website have not been evaluated by the US Food and Drug Administration. The statements and the products of this company are not intended to diagnose, treat, cure or prevent any disease.
Element CRP is a chemical supplier. Element CRP is not a compounding pharmacy or chemical compounding facility as defined under 503A of the Federal Food, Drug, and Cosmetic act. Element CRP is not an outsourcing facility as defined under 503B of the Federal Food, Drug, and Cosmetic act.